ERK1 anticorps (AA 336-367)

N° du produit ABIN351563

L’anticorps Lapin Polyclonal anti-ERK1 a été validé pour WB, IHC et IP. Il convient pour détecter ERK1 dans des échantillons de Souris, Rat, Lapin et Hamster.

Aperçu rapide pour ERK1 anticorps (AA 336-367) (ABIN351563)

Antigène: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Reactivité: Souris, Rat, Lapin, Hamster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERK1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Détail du produit anti-ERK1 anticorps

Épitope: AA 336-367

Specificité: This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.

Homologie: Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).

Purification: Protein A purified

Immunogène: A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated

Information d'application

Indications d'application: Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB

Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract.

Commentaires:

Target Species of Antibody: Rat

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Liquid

Conseil sur la manipulation: Avoid repeat freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Détails sur ERK1

Antigène: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Autre désignation: MAPK3 / ERK1

Sujet: Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3

ID gène: 5595

UniProt: P27361

Pathways: Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins